Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. RID: 1039752343-028193-367 Query= (293 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters If you have any problems or questions with the results of this search please refer to the BLAST FAQs Taxonomy reports
RID: 1039752343-028193-367
Query= (293 letters)
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters
If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports
Related Structures Score E Sequences producing significant alignments: (bits) Value gi|13359451|dbj|BAB33421.1| putative senescence-associated ... 167 2e-42 gi|23482977|gb|EAA18798.1| hypothetical protein [Plasmodium... 60 5e-09 gi|23479816|gb|EAA16545.1| hypothetical protein [Plasmodium... 57 4e-08 gi|23488483|gb|EAA21327.1| putative senescence-associated p... 56 1e-07 gi|15834739|ref|NP_296498.1| hypothetical protein [Chlamydi... 40 0.007 gi|11282814|pir||G81737 hypothetical protein TC0130 [import... 40 0.007 gi|15921441|ref|NP_377110.1| 62aa long conserved hypothetic... 39 0.021 gi|14590152|ref|NP_142217.1| hypothetical protein [Pyrococc... 33 0.88 gi|7657166|ref|NP_055027.1| homeo box C11; homeobox protein... 30 5.7 gi|7516816|pir||G72579 hypothetical protein APE1919 - Aerop... 30 7.4 gi|21300339|gb|EAA12484.1| agCP11254 [Anopheles gambiae str... 30 9.7 gi|24158778|pdb|1KB9|H Chain H, Yeast Cytochrome Bc1 Comple... 30 9.7 gi|6322295|ref|NP_012369.1| Ubiquinol cytochrome-c reductas... 30 9.7 Alignments
Related Structures Score E Sequences producing significant alignments: (bits) Value gi|13359451|dbj|BAB33421.1| putative senescence-associated ... 167 2e-42 gi|23482977|gb|EAA18798.1| hypothetical protein [Plasmodium... 60 5e-09 gi|23479816|gb|EAA16545.1| hypothetical protein [Plasmodium... 57 4e-08 gi|23488483|gb|EAA21327.1| putative senescence-associated p... 56 1e-07 gi|15834739|ref|NP_296498.1| hypothetical protein [Chlamydi... 40 0.007 gi|11282814|pir||G81737 hypothetical protein TC0130 [import... 40 0.007 gi|15921441|ref|NP_377110.1| 62aa long conserved hypothetic... 39 0.021 gi|14590152|ref|NP_142217.1| hypothetical protein [Pyrococc... 33 0.88 gi|7657166|ref|NP_055027.1| homeo box C11; homeobox protein... 30 5.7 gi|7516816|pir||G72579 hypothetical protein APE1919 - Aerop... 30 7.4 gi|21300339|gb|EAA12484.1| agCP11254 [Anopheles gambiae str... 30 9.7 gi|24158778|pdb|1KB9|H Chain H, Yeast Cytochrome Bc1 Comple... 30 9.7 gi|6322295|ref|NP_012369.1| Ubiquinol cytochrome-c reductas... 30 9.7
>gi|13359451|dbj|BAB33421.1| putative senescence-associated protein [Pisum sativum] Length = 282 Score = 167 bits (424), Expect(2) = 2e-42 Identities = 78/84 (92%), Positives = 78/84 (92%) Frame = +3 Query: 6 VELLSRHGHQ*GKTNLSHDGLIPAHVPYWWVNNPTLGEFCFTMIGRADIEGSKSNVAMNA 185 VELL RH HQ GKTNLSHDGLIPAHVPYWWVNNPTLGEFCFTMIGRADIEGSKSNVAMNA Sbjct: 49 VELLLRHCHQWGKTNLSHDGLIPAHVPYWWVNNPTLGEFCFTMIGRADIEGSKSNVAMNA 108 Query: 186 WLPQASYPCGNFSDTSSFKLRRSK 257 WLPQASYPCGNFSDTSSFK R K Sbjct: 109 WLPQASYPCGNFSDTSSFKFRSLK 132
Score = 25.4 bits (54), Expect(2) = 2e-42 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 253 LKDR*ATLSRFVF 291 LKDR ATLSRFVF Sbjct: 131 LKDRLATLSRFVF 143
>gi|23482977|gb|EAA18798.1| hypothetical protein [Plasmodium yoelii yoelii] Length = 107 Score = 60.5 bits (145), Expect = 5e-09 Identities = 34/50 (68%), Positives = 36/50 (72%) Frame = +3 Query: 132 MIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSFKLRRSKGSIGHAFT 281 MIGRADIEGSKS VA +AW PQASYPC SF + KGSIGHAFT Sbjct: 1 MIGRADIEGSKSYVARSAWQPQASYPC-----VPSF--CKYKGSIGHAFT 43
>gi|23479816|gb|EAA16545.1| hypothetical protein [Plasmodium yoelii yoelii] Length = 177 Score = 57.4 bits (137), Expect = 4e-08 Identities = 31/50 (62%), Positives = 32/50 (64%) Frame = +3 Query: 132 MIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSFKLRRSKGSIGHAFT 281 MIGRADIEGSKS VA +AW PQASYPC GSIGHAFT Sbjct: 1 MIGRADIEGSKSYVARSAWQPQASYPC---------------GSIGHAFT 35
>gi|23488483|gb|EAA21327.1| putative senescence-associated protein [Plasmodium yoelii yoelii] Length = 205 Score = 56.2 bits (134), Expect = 1e-07 Identities = 31/50 (62%), Positives = 31/50 (62%) Frame = +3 Query: 132 MIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSFKLRRSKGSIGHAFT 281 MIGRADIE SKS VA NAW PQASYPC GSIGHAFT Sbjct: 1 MIGRADIERSKSYVAKNAWQPQASYPC---------------GSIGHAFT 35
>gi|15834739|ref|NP_296498.1| hypothetical protein [Chlamydia muridarum] gi|11282815|pir||F81738 hypothetical protein TC0114 [imported] - Chlamydia muridarum (strain Nigg) gi|7190150|gb|AAF38993.1| hypothetical protein [Chlamydia muridarum] Length = 122 Score = 40.0 bits (92), Expect = 0.007 Identities = 21/38 (55%), Positives = 22/38 (57%) Frame = +2 Query: 95 GEQSNTW*ILLHNDRKSRHRRIKKQRRYERLAATSQLS 208 GEQ N W +L D SRHR K RRYE L A S LS Sbjct: 66 GEQPNPWDLLQPQDAMSRHRGAKPPRRYELLVAISLLS 103
>gi|11282814|pir||G81737 hypothetical protein TC0130 [imported] - Chlamydia muridarum (strain Nigg) Length = 122 Score = 40.0 bits (92), Expect = 0.007 Identities = 21/38 (55%), Positives = 22/38 (57%) Frame = +2 Query: 95 GEQSNTW*ILLHNDRKSRHRRIKKQRRYERLAATSQLS 208 GEQ N W +L D SRHR K RRYE L A S LS Sbjct: 66 GEQPNPWDLLQPQDAMSRHRGAKPPRRYELLVAISLLS 103
>gi|15921441|ref|NP_377110.1| 62aa long conserved hypothetical protein [Sulfolobus tokodaii] gi|15622227|dbj|BAB66219.1| 62aa long conserved hypothetical protein [Sulfolobus tokodaii] Length = 62 Score = 38.5 bits (88), Expect = 0.021 Identities = 23/51 (45%), Positives = 27/51 (52%) Frame = -1 Query: 224 RKVTTGITGLWQPSVHSDVAF*SFDVGSSYHCEAEFTKCWIVHPPIGNVSW 72 RKVT GITG + H D A DVGSS+ A K P +G+VSW Sbjct: 11 RKVTPGITGSSRARAHIDPAVCYIDVGSSHPGGAAAPKGRAARPLMGSVSW 61
>gi|14590152|ref|NP_142217.1| hypothetical protein [Pyrococcus horikoshii] gi|7519378|pir||F71245 hypothetical protein PHS004 - Pyrococcus horikoshii gi|3256610|dbj|BAA29293.1| 58aa long hypothetical protein [Pyrococcus horikoshii] Length = 58 Score = 33.1 bits (74), Expect = 0.88 Identities = 23/55 (41%), Positives = 25/55 (45%) Frame = -1 Query: 236 ARGVRKVTTGITGLWQPSVHSDVAF*SFDVGSSYHCEAEFTKCWIVHPPIGNVSW 72 AR RK T GIT + H D VGS + A K VHP GNVSW Sbjct: 3 ARDDRKATLGITESSRARAHIDPEACYLAVGSPHPGPAAGAKGGGVHPLKGNVSW 57
>gi|7657166|ref|NP_055027.1| homeo box C11; homeobox protein Hox-C11 [Homo sapiens] gi|13651009|ref|XP_012215.2| similar to Homeobox protein Hox-C11 [Homo sapiens] gi|3287858|sp|O43248|HXCB_HUMAN Homeobox protein Hox-C11 gi|2661373|emb|CAA03876.1| Hox protein [Homo sapiens] Length = 304 Score = 30.4 bits (67), Expect = 5.7 Identities = 17/65 (26%), Positives = 29/65 (44%), Gaps = 1/65 (1%) Frame = +3 Query: 99 NNPTLGEFCFTMIGRADIE-GSKSNVAMNAWLPQASYPCGNFSDTSSFKLRRSKGSIGHA 275 N+ LG FC + G + + A N +LP +Y FS SSF + I + Sbjct: 3 NSVNLGNFCSPSRKERGADFGERGSCASNLYLPSCTYYMPEFSTVSSFLPQAPSRQISYP 62 Query: 276 FTVRI 290 ++ ++ Sbjct: 63 YSAQV 67
>gi|7516816|pir||G72579 hypothetical protein APE1919 - Aeropyrum pernix (strain K1) gi|5105611|dbj|BAA80924.1| 128aa long hypothetical protein [Aeropyrum pernix] Length = 128 Score = 30.0 bits (66), Expect = 7.4 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = +3 Query: 42 KTNLSHDGLIPAHVP 86 +T+LSHDGL PAHVP Sbjct: 113 ETDLSHDGLNPAHVP 127
>gi|21300339|gb|EAA12484.1| agCP11254 [Anopheles gambiae str. PEST] Length = 482 Score = 29.6 bits (65), Expect = 9.7 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = +3 Query: 27 GHQ*GKTNLSHDGLIPAHVPYWWVNNPTLGEFCFTMIGRADIEGSKSNVAM 179 GH+ +++H G WW N T+ ++ M+G+A+I SNV M Sbjct: 207 GHEIAVHSITHRG-----PEEWWSRNATIEDWFDEMVGQANIINRFSNVRM 252
>gi|24158778|pdb|1KB9|H Chain H, Yeast Cytochrome Bc1 Complex gi|14277719|pdb|1EZV|G Chain G, Structure Of The Yeast Cytochrome Bc1 Complex Co- Crystallized With An Antibody Fv-Fragment gi|20151125|pdb|1KYO|H Chain H, Yeast Cytochrome Bc1 Complex With Bound Substrate Cytochrome C gi|20151136|pdb|1KYO|S Chain S, Yeast Cytochrome Bc1 Complex With Bound Substrate Cytochrome C Length = 93 Score = 29.6 bits (65), Expect = 9.7 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +3 Query: 66 LIPAHVP-YWWVNNPTLGEFCFTMIGRADIE 155 LIPA + YWW N EF ++ GR ++E Sbjct: 59 LIPAGIYWYWWKNGNEYNEFLYSKAGREELE 89
>gi|6322295|ref|NP_012369.1| Ubiquinol cytochrome-c reductase subunit 8 (11 kDa protein); Qcr8p [Saccharomyces cerevisiae] gi|418147|sp|P08525|UCRQ_YEAST Ubiquinol-cytochrome C reductase complex ubiquinone-binding protein QP-C (Ubiquinol-cytochrome C reductase complex 11 kDa protein) (Complex III subunit VIII) gi|626969|pir||S48138 ubiquinol-cytochrome-c reductase (EC 1.10.2.2) chain VIII - yeast (Saccharomyces cerevisiae) gi|312354|emb|CAA29065.1| 11 kDa subunit VIII (AA1-94) [Saccharomyces cerevisiae] gi|1008356|emb|CAA89461.1| ORF YJL166w [Saccharomyces cerevisiae] Length = 94 Score = 29.6 bits (65), Expect = 9.7 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +3 Query: 66 LIPAHVP-YWWVNNPTLGEFCFTMIGRADIE 155 LIPA + YWW N EF ++ GR ++E Sbjct: 60 LIPAGIYWYWWKNGNEYNEFLYSKAGREELE 90
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Dec 9, 2002 8:40 PM Number of letters in database: 397,579,747 Number of sequences in database: 1,247,039 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 195,503,465 Number of Sequences: 1247039 Number of extensions: 3423307 Number of successful extensions: 7993 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 7938 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7986 length of database: 397,579,747 effective HSP length: 73 effective length of database: 306,545,900 effective search space used: 7357101600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)