Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. RID: 1039752539-029708-7637 Query= (334 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters If you have any problems or questions with the results of this search please refer to the BLAST FAQs Taxonomy reports
RID: 1039752539-029708-7637
Query= (334 letters)
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters
If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports
Score E Sequences producing significant alignments: (bits) Value gi|7509739|pir||T33462 hypothetical protein Y40D12A.3 - Cae... 32 1.4 gi|17554856|ref|NP_498459.1| Predicted CDS, serpentine Rece... 32 1.4 gi|25026547|ref|XP_203552.1| expressed sequence AI593546 [M... 31 4.1 gi|19353673|gb|AAH24801.1| similar to unnamed protein produ... 31 4.1 Alignments
Score E Sequences producing significant alignments: (bits) Value gi|7509739|pir||T33462 hypothetical protein Y40D12A.3 - Cae... 32 1.4 gi|17554856|ref|NP_498459.1| Predicted CDS, serpentine Rece... 32 1.4 gi|25026547|ref|XP_203552.1| expressed sequence AI593546 [M... 31 4.1 gi|19353673|gb|AAH24801.1| similar to unnamed protein produ... 31 4.1
>gi|7509739|pir||T33462 hypothetical protein Y40D12A.3 - Caenorhabditis elegans Length = 366 Score = 32.3 bits (72), Expect = 1.4 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = -3 Query: 269 LCHVCCSDTWRYILVSSKFYYEVSGCELEMSSYYYLLPNCWLYFEV 132 LC + C TW +++ F+ V G L +S Y+ N +YF V Sbjct: 64 LCTMFCDFTWGILVIPMMFWSVVCGYTLGISKYFINSKNILMYFGV 109
>gi|17554856|ref|NP_498459.1| Predicted CDS, serpentine Receptor, class H SRH-40 (srh-40) [Caenorhabditis elegans] gi|20198898|gb|AAC26947.2| Serpentine receptor, class h protein 40 [Caenorhabditis elegans] Length = 352 Score = 32.3 bits (72), Expect = 1.4 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = -3 Query: 269 LCHVCCSDTWRYILVSSKFYYEVSGCELEMSSYYYLLPNCWLYFEV 132 LC + C TW +++ F+ V G L +S Y+ N +YF V Sbjct: 64 LCTMFCDFTWGILVIPMMFWSVVCGYTLGISKYFINSKNILMYFGV 109
>gi|25026547|ref|XP_203552.1| expressed sequence AI593546 [Mus musculus] Length = 408 Score = 30.8 bits (68), Expect = 4.1 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 4/46 (8%) Frame = -3 Query: 269 LCHVCCSDT----WRYILVSSKFYYEVSGCELEMSSYYYLLPNCWL 144 LC+ C S W +VSS+FY G L M YLLP CW+ Sbjct: 168 LCYTCESAYRVLHWENPVVSSQFY----GALLGMVCMLYLLPLCWV 209
>gi|19353673|gb|AAH24801.1| similar to unnamed protein product [Mus musculus] Length = 238 Score = 30.8 bits (68), Expect = 4.1 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 4/46 (8%) Frame = -3 Query: 269 LCHVCCSDT----WRYILVSSKFYYEVSGCELEMSSYYYLLPNCWL 144 LC+ C S W +VSS+FY G L M YLLP CW+ Sbjct: 100 LCYTCESAYRVLHWENPVVSSQFY----GALLGMVCMLYLLPLCWV 141
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Dec 9, 2002 8:40 PM Number of letters in database: 397,579,747 Number of sequences in database: 1,247,039 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 185,990,369 Number of Sequences: 1247039 Number of extensions: 3064239 Number of successful extensions: 6782 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 6712 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6781 length of database: 397,579,747 effective HSP length: 86 effective length of database: 290,334,393 effective search space used: 6968025432 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)